General Information

  • ID:  hor005632
  • Uniprot ID:  Q8UW82
  • Protein name:  Gonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Brain; ventromedial olfactory bulbs and terminal nerve ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPG
  • Length:  10
  • Propeptide:  MEASSRLVVQVLVLMLVVQVALSQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERPRPYNVIDDGSRHFHRKKRFPDN
  • Signal peptide:  MEASSRLVVQVLVLMLVVQVALS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9IA09-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005632_AF2.pdbhor005632_ESM.pdb

Physical Information

Mass: 139106 Formula: C60H75N15O14
Absent amino acids: ACDEFIKMNRTV Common amino acids: GW
pI: 7.54 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -92 Boman Index: -228
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 4157 Extinction Coefficient cystines: 12490
Absorbance 280nm: 1387.78

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.